Lineage for d1qlda_ (1qld A:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41138Fold g.29: Type X cellulose binding domain, CBDX [57614] (1 superfamily)
  4. 41139Superfamily g.29.1: Type X cellulose binding domain, CBDX [57615] (1 family) (S)
  5. 41140Family g.29.1.1: Type X cellulose binding domain, CBDX [57616] (1 protein)
  6. 41141Protein Endo-1;4-beta-xylanase A CBDX [57617] (1 species)
  7. 41142Species Pseudomonas fluorescens, subsp. cellulosa [TaxId:294] [57618] (2 PDB entries)
  8. 41144Domain d1qlda_: 1qld A: [44961]

Details for d1qlda_

PDB Entry: 1qld (more details)

PDB Description: solution structure of type x cbm

SCOP Domain Sequences for d1qlda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qlda_ g.29.1.1 (A:) Endo-1;4-beta-xylanase A CBDX {Pseudomonas fluorescens, subsp. cellulosa}
mgnqqcnwygtlyplcvtttngwgwedqrsciarstcaaqpapfgivgsg

SCOP Domain Coordinates for d1qlda_:

Click to download the PDB-style file with coordinates for d1qlda_.
(The format of our PDB-style files is described here.)

Timeline for d1qlda_: