Lineage for d1e8ba3 (1e8b A:1-41)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064849Fold g.27: FnI-like domain [57602] (1 superfamily)
    disulfide-rich, all-beta
  4. 1064850Superfamily g.27.1: FnI-like domain [57603] (2 families) (S)
  5. 1064851Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 1064852Protein Fibronectin [57605] (1 species)
  7. 1064853Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries)
  8. 1064894Domain d1e8ba3: 1e8b A:1-41 [44951]
    Other proteins in same PDB: d1e8ba1, d1e8ba2
    part of the gelatin-binding domain
    complexed with nag

Details for d1e8ba3

PDB Entry: 1e8b (more details)

PDB Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1e8ba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e8ba3 g.27.1.1 (A:1-41) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqet

SCOPe Domain Coordinates for d1e8ba3:

Click to download the PDB-style file with coordinates for d1e8ba3.
(The format of our PDB-style files is described here.)

Timeline for d1e8ba3: