| Class g: Small proteins [56992] (90 folds) |
| Fold g.27: FnI-like domain [57602] (1 superfamily) disulfide-rich, all-beta |
Superfamily g.27.1: FnI-like domain [57603] (2 families) ![]() |
| Family g.27.1.1: Fibronectin type I module [57604] (2 proteins) |
| Protein Fibronectin [57605] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57606] (13 PDB entries) |
| Domain d1e8ba3: 1e8b A:1-41 [44951] Other proteins in same PDB: d1e8ba1, d1e8ba2 part of the gelatin-binding domain complexed with nag |
PDB Entry: 1e8b (more details)
SCOPe Domain Sequences for d1e8ba3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e8ba3 g.27.1.1 (A:1-41) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqet
Timeline for d1e8ba3: