Lineage for d1e88a3 (1e88 A:1-41)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204423Fold g.27: Fibronectin type I module [57602] (1 superfamily)
  4. 204424Superfamily g.27.1: Fibronectin type I module [57603] (1 family) (S)
  5. 204425Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)
  6. 204426Protein Fibronectin [57605] (1 species)
  7. 204427Species Human (Homo sapiens) [TaxId:9606] [57606] (5 PDB entries)
  8. 204430Domain d1e88a3: 1e88 A:1-41 [44950]
    Other proteins in same PDB: d1e88a1, d1e88a2

Details for d1e88a3

PDB Entry: 1e88 (more details)

PDB Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin

SCOP Domain Sequences for d1e88a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e88a3 g.27.1.1 (A:1-41) Fibronectin {Human (Homo sapiens)}
yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqet

SCOP Domain Coordinates for d1e88a3:

Click to download the PDB-style file with coordinates for d1e88a3.
(The format of our PDB-style files is described here.)

Timeline for d1e88a3: