SCOP 1.59: Domain d1e88a3: 1e88 A:1-41

Lineage for d1e88a3 (1e88 A:1-41)

1. Root: SCOP 1.59

2. Class g: Small proteins [56992] (58 folds)

3. Fold g.27: Fibronectin type I module [57602] (1 superfamily)

4. Superfamily g.27.1: Fibronectin type I module [57603] (1 family)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Fibronectin [57605] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57606] (5 PDB entries)

8. Domain d1e88a3: 1e88 A:1-41 [44950]
   Other proteins in same PDB: d1e88a1, d1e88a2

Details for d1e88a3

PDB Entry: 1e88

PDB Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin

SCOP Domain Sequences for d1e88a3:

Sequence; same for both SEQRES and ATOM records:

>d1e88a3 g.27.1.1 (A:1-41) Fibronectin {Human (Homo sapiens)}
yghcvtdsgvvysvgmqwlktqgnkqmlctclgngvscqet

Timeline for d1e88a3:

• d1e88a3 first appeared (with stable ids) in SCOP 1.55
  
• d1e88a3 appears in SCOP 1.57
  
• d1e88a3 appears in SCOP 1.61
  
• d1e88a3 appears in the current release, SCOPe 2.08