SCOPe 2.06: Domain d1atba_: 1atb A:

Lineage for d1atba_ (1atb A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.22: Serine protease inhibitors [57566] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.22.1: Serine protease inhibitors [57567] (2 families)

5. Family g.22.1.1: ATI-like [57568] (5 proteins)
   automatically mapped to Pfam PF01826

6. Protein Ascaris trypsin inhibitor, ATI [57569] (1 species)

7. Species Pig roundworm (Ascaris suum) [TaxId:6253] [57570] (4 PDB entries)

8. Domain d1atba_: 1atb A: [44890]

Details for d1atba_

PDB Entry: 1atb

PDB Description: high-resolution structure of ascaris trypsin inhibitor in solution: direct evidence for a ph induced conformational transition in the reactive site

PDB Compounds: (A:) ascaris trypsin inhibitor

SCOPe Domain Sequences for d1atba_:

Sequence; same for both SEQRES and ATOM records:

>d1atba_ g.22.1.1 (A:) Ascaris trypsin inhibitor, ATI {Pig roundworm (Ascaris suum) [TaxId: 6253]}
eaekctkpneqwtkcggcegtcaqkivpctreckpprceciasagfvrdaqgncikfedc
pk

Timeline for d1atba_:

• d1atba_ first appeared (with stable ids) in SCOP 1.55, called d1atb__
  
• d1atba_ appears in SCOPe 2.05
  
• d1atba_ appears in SCOPe 2.07
  
• d1atba_ appears in the current release, SCOPe 2.08