Class g: Small proteins [56992] (100 folds) |
Fold g.22: Serine protease inhibitors [57566] (1 superfamily) disulfide-rich; nearly all-beta |
Superfamily g.22.1: Serine protease inhibitors [57567] (2 families) |
Family g.22.1.1: ATI-like [57568] (5 proteins) automatically mapped to Pfam PF01826 |
Protein Ascaris trypsin inhibitor, ATI [57569] (1 species) |
Species Pig roundworm (Ascaris suum) [TaxId:6253] [57570] (4 PDB entries) |
Domain d1atba_: 1atb A: [44890] |
PDB Entry: 1atb (more details)
SCOPe Domain Sequences for d1atba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1atba_ g.22.1.1 (A:) Ascaris trypsin inhibitor, ATI {Pig roundworm (Ascaris suum) [TaxId: 6253]} eaekctkpneqwtkcggcegtcaqkivpctreckpprceciasagfvrdaqgncikfedc pk
Timeline for d1atba_: