| Class g: Small proteins [56992] (100 folds) |
| Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) ![]() |
| Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
| Protein Complement control protein [57539] (1 species) |
| Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries) Uniprot P10998 a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans |
| Domain d1g40b4: 1g40 B:185-243 [44830] |
PDB Entry: 1g40 (more details), 2.2 Å
SCOPe Domain Sequences for d1g40b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g40b4 g.18.1.1 (B:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]}
vkcphptisngylssgfkrsysyndnvdfkckygyklsgsssstcspgntwkpelpkcv
Timeline for d1g40b4:
View in 3DDomains from other chains: (mouse over for more information) d1g40a1, d1g40a2, d1g40a3, d1g40a4 |