SCOPe 2.08: Domain d1g40a4: 1g40 A:185-243

Lineage for d1g40a4 (1g40 A:185-243)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
   disulfide-rich all-beta fold

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
   Pfam PF00084

6. Protein Complement control protein [57539] (1 species)

7. Species Vaccinia virus [TaxId:10245] [57540] (8 PDB entries)
   Uniprot P10998
   a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

8. Domain d1g40a4: 1g40 A:185-243 [44826]

Details for d1g40a4

PDB Entry: 1g40, 2.2 Å

PDB Description: crystal structure of a complement protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

PDB Compounds: (A:) complement control protein

SCOPe Domain Sequences for d1g40a4:

Sequence; same for both SEQRES and ATOM records:

>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]}
vkcphptisngylssgfkrsysyndnvdfkckygyklsgsssstcspgntwkpelpkcv

Timeline for d1g40a4:

• d1g40a4 first appeared (with stable ids) in SCOP 1.55
  
• d1g40a4 appears in SCOPe 2.07