![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
![]() | Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) ![]() |
![]() | Family g.18.1.1: Complement control module/SCR domain [57536] (13 proteins) Pfam PF00084 |
![]() | Protein Factor H, 15th and 16th modules [57537] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57538] (3 PDB entries) |
![]() | Domain d1hfia_: 1hfi A: [44819] 15th module only |
PDB Entry: 1hfi (more details)
SCOP Domain Sequences for d1hfia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} ekipcsqppqiehgtinssrssqesyahgtklsytceggfriseenettcymgkwssppq ce
Timeline for d1hfia_: