PDB entry 1hfi

View 1hfi on RCSB PDB site
Description: solution structure of a pair of complement modules by nuclear magnetic resonance
Class: glycoprotein
Keywords: glycoprotein
Deposited on 1993-02-23, released 1993-07-15
The last revision prior to the SCOP 1.73 freeze date was dated 1995-07-20, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor h, 15th c-module pair
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1hfia_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hfiA (A:)
    ekipcsqppqiehgtinssrssqesyahgtklsytceggfriseenettcymgkwssppq
    ce