Lineage for d1hrpa_ (1hrp A:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144107Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 144108Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families) (S)
  5. 144203Family g.17.1.4: Gonadodropin/Follitropin [57528] (3 proteins)
  6. 144208Protein Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) [63395] (1 species)
  7. 144209Species Human (Homo sapiens) [TaxId:9606] [63397] (6 PDB entries)
  8. 144211Domain d1hrpa_: 1hrp A: [44811]
    Other proteins in same PDB: d1hrpb_

Details for d1hrpa_

PDB Entry: 1hrp (more details), 3 Å

PDB Description: crystal structure of human chorionic gonadotropin

SCOP Domain Sequences for d1hrpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrpa_ g.17.1.4 (A:) Glycoprotein hormones alpha chain (Gonadotropin A, Follitropin alpha) {Human (Homo sapiens)}
tqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvak
synrvtvmggfkvenhtachcstcyy

SCOP Domain Coordinates for d1hrpa_:

Click to download the PDB-style file with coordinates for d1hrpa_.
(The format of our PDB-style files is described here.)

Timeline for d1hrpa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hrpb_