PDB entry 1hrp

View 1hrp on RCSB PDB site
Description: crystal structure of human chorionic gonadotropin
Deposited on 1994-08-15, released 1994-11-01
The last revision prior to the SCOP 1.59 freeze date was dated 1994-11-01, with a file datestamp of 1994-11-11.
Experiment type: -
Resolution: 3 Å
R-factor: 0.218
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1hrpa_
  • Chain 'B':
    Domains in SCOP 1.59: d1hrpb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hrpA (A:)
tqdcpectlqenpffsqpgapilqcmgccfsrayptplrskktmlvqknvtsestccvak
synrvtvmggfkvenhtachcstcyy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1hrpB (B:)
keplrprcrpinatlavekegcpvcitvntticagycptmtrvlqgvlpalpqvvcnyrd
vrfesirlpgcprgvnpvvsyavalscqcalcrrsttdcggpkdhpltcd