![]() | Class g: Small proteins [56992] (79 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) ![]() |
![]() | Family g.17.1.3: Neurotrophin [57520] (4 proteins) |
![]() | Protein Brain-derived neurotrophic factor, BDNF [88882] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88883] (2 PDB entries) |
![]() | Domain d1bnda_: 1bnd A: [44793] Other proteins in same PDB: d1bndb_ heterodimer with NT3 complexed with ipa |
PDB Entry: 1bnd (more details), 2.3 Å
SCOP Domain Sequences for d1bnda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bnda_ g.17.1.3 (A:) Brain-derived neurotrophic factor, BDNF {Human (Homo sapiens)} gqlsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik
Timeline for d1bnda_: