SCOP 1.73: Domain d1bnda_: 1bnd A:

Lineage for d1bnda_ (1bnd A:)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families)

5. Family g.17.1.3: Neurotrophin [57520] (4 proteins)

6. Protein Brain-derived neurotrophic factor, BDNF [88882] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88883] (2 PDB entries)

8. Domain d1bnda_: 1bnd A: [44793]
   Other proteins in same PDB: d1bndb_
   heterodimer with NT3
   complexed with ipa

Details for d1bnda_

PDB Entry: 1bnd, 2.3 Å

PDB Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer

PDB Compounds: (A:) brain derived neurotrophic factor

SCOP Domain Sequences for d1bnda_:

Sequence; same for both SEQRES and ATOM records:

>d1bnda_ g.17.1.3 (A:) Brain-derived neurotrophic factor, BDNF {Human (Homo sapiens) [TaxId: 9606]}
gqlsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik

Timeline for d1bnda_:

• d1bnda_ first appeared (with stable ids) in SCOP 1.55
  
• d1bnda_ appears in SCOP 1.71
  
• d1bnda_ appears in SCOP 1.75
  
• d1bnda_ appears in the current release, SCOPe 2.08