Lineage for d1bnda_ (1bnd A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033576Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 3033577Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 3033808Family g.17.1.3: Neurotrophin [57520] (5 proteins)
    automatically mapped to Pfam PF00243
  6. 3033831Protein Brain-derived neurotrophic factor, BDNF [88882] (1 species)
  7. 3033832Species Human (Homo sapiens) [TaxId:9606] [88883] (2 PDB entries)
  8. 3033833Domain d1bnda_: 1bnd A: [44793]
    Other proteins in same PDB: d1bndb_
    heterodimer with NT3
    complexed with ipa

Details for d1bnda_

PDB Entry: 1bnd (more details), 2.3 Å

PDB Description: structure of the brain-derived neurotrophic factor(slash)neurotrophin 3 heterodimer
PDB Compounds: (A:) brain derived neurotrophic factor

SCOPe Domain Sequences for d1bnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bnda_ g.17.1.3 (A:) Brain-derived neurotrophic factor, BDNF {Human (Homo sapiens) [TaxId: 9606]}
gqlsvcdsisewvtaadkktavdmsggtvtvlekvpvskgqlkqyfyetkcnpmgytkeg
crgidkrhwnsqcrttqsyvraltmdskkrigwrfiridtscvctltik

SCOPe Domain Coordinates for d1bnda_:

Click to download the PDB-style file with coordinates for d1bnda_.
(The format of our PDB-style files is described here.)

Timeline for d1bnda_: