Lineage for d1tfg__ (1tfg -)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144107Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
  4. 144108Superfamily g.17.1: Cystine-knot cytokines [57501] (6 families) (S)
  5. 144145Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (6 proteins)
  6. 144168Protein TGF-beta2 [57510] (1 species)
  7. 144169Species Human (Homo sapiens) [TaxId:9606] [57511] (2 PDB entries)
  8. 144171Domain d1tfg__: 1tfg - [44778]

Details for d1tfg__

PDB Entry: 1tfg (more details), 1.95 Å

PDB Description: an unusual feature revealed by the crystal structure at 2.2 angstroms resolution of human transforming growth factor-beta2

SCOP Domain Sequences for d1tfg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tfg__ g.17.1.2 (-) TGF-beta2 {Human (Homo sapiens)}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs

SCOP Domain Coordinates for d1tfg__:

Click to download the PDB-style file with coordinates for d1tfg__.
(The format of our PDB-style files is described here.)

Timeline for d1tfg__: