PDB entry 1tfg

View 1tfg on RCSB PDB site
Description: an unusual feature revealed by the crystal structure at 2.2 angstroms resolution of human transforming growth factor-beta2
Deposited on 1992-11-17, released 1993-10-31
The last revision prior to the SCOP 1.59 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.95 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.59: d1tfg__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1tfg_ (-)
    aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpylwssdtqhsr
    vlslyntinpeasaspccvsqdlepltilyyigktpkieqlsnmivksckcs