SCOP 1.67: Domain d1cgii_: 1cgi I:

Lineage for d1cgii_ (1cgi I:)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (2 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (10 proteins)

6. Protein Secretory trypsin inhibitor [57473] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries)

8. Domain d1cgii_: 1cgi I: [44704]
   Other proteins in same PDB: d1cgie_

Details for d1cgii_

PDB Entry: 1cgi, 2.3 Å

PDB Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)

SCOP Domain Sequences for d1cgii_:

Sequence; same for both SEQRES and ATOM records:

>d1cgii_ g.68.1.1 (I:) Secretory trypsin inhibitor {Human (Homo sapiens)}
dslgreakcynelngctyeyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc

Timeline for d1cgii_:

• d1cgii_ first appeared (with stable ids) in SCOP 1.55
  
• d1cgii_ appears in SCOP 1.65
  
• d1cgii_ appears in SCOP 1.69
  
• d1cgii_ appears in the current release, SCOPe 2.08