![]() | Class g: Small proteins [56992] (66 folds) |
![]() | Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily) disulphide-rich small alpha+beta fold |
![]() | Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) ![]() two families share the same beta-sheet topology but differ in the active-site loop location |
![]() | Family g.15.1.1: Animal Kazal-type inhibitors [57468] (10 proteins) |
![]() | Protein Secretory trypsin inhibitor [57473] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries) |
![]() | Domain d1cgii_: 1cgi I: [44704] Other proteins in same PDB: d1cgie_ |
PDB Entry: 1cgi (more details), 2.3 Å
SCOP Domain Sequences for d1cgii_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cgii_ g.15.1.1 (I:) Secretory trypsin inhibitor {Human (Homo sapiens)} dslgreakcynelngctyeyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc
Timeline for d1cgii_: