SCOP 1.67: Domain d1cgie_: 1cgi E:

Lineage for d1cgie_ (1cgi E:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (50 PDB entries)

8. Domain d1cgie_: 1cgi E: [26059]
   Other proteins in same PDB: d1cgii_

Details for d1cgie_

PDB Entry: 1cgi, 2.3 Å

PDB Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)

SCOP Domain Sequences for d1cgie_:

Sequence; same for both SEQRES and ATOM records:

>d1cgie_ b.47.1.2 (E:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus)}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Timeline for d1cgie_:

• d1cgie_ first appeared (with stable ids) in SCOP 1.55
  
• d1cgie_ appears in SCOP 1.65
  
• d1cgie_ appears in SCOP 1.69
  
• d1cgie_ appears in the current release, SCOPe 2.08