SCOPe 2.08: Domain d2sgpi_: 2sgp I:

Lineage for d2sgpi_ (2sgp I:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Ovomucoid domains [57469] (3 species)
   unless specified in the comment, the listed structures are of domain III

7. Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries)

8. Domain d2sgpi_: 2sgp I: [44689]
   Other proteins in same PDB: d2sgpe_
   complexed with po4

Details for d2sgpi_

PDB Entry: 2sgp, 1.8 Å

PDB Description: pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5

PDB Compounds: (I:) ovomucoid inhibitor

SCOPe Domain Sequences for d2sgpi_:

Sequence; same for both SEQRES and ATOM records:

>d2sgpi_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]}
vdcseypkpactpeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc

Timeline for d2sgpi_:

• d2sgpi_ first appeared (with stable ids) in SCOP 1.55
  
• d2sgpi_ appears in SCOPe 2.07