![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
![]() | Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) ![]() conserved core consists of a helix and a loop crosslinked with two disulfides |
![]() | Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
![]() | Protein Ovomucoid domains [57469] (3 species) unless specified in the comment, the listed structures are of domain III |
![]() | Species Turkey (Meleagris gallopavo) [TaxId:9103] [57470] (37 PDB entries) |
![]() | Domain d2sgpi_: 2sgp I: [44689] Other proteins in same PDB: d2sgpe_ complexed with po4 |
PDB Entry: 2sgp (more details), 1.8 Å
SCOPe Domain Sequences for d2sgpi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2sgpi_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} vdcseypkpactpeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc
Timeline for d2sgpi_: