PDB entry 2sgp

View 2sgp on RCSB PDB site
Description: pro 18 variant of turkey ovomucoid inhibitor third domain complexed with streptomyces griseus proteinase b at ph 6.5
Class: hydrolase/inhibitor
Keywords: complex (serine protease-inhibitor), serine proteinase, protein inhibitor, hydrolase-inhibitor complex
Deposited on 1999-03-25, released 2001-01-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: proteinase b
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2sgpe_
  • Chain 'I':
    Compound: ovomucoid inhibitor
    Species: Meleagris gallopavo [TaxId:9103]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68390 (0-50)
      • engineered (12)
    Domains in SCOPe 2.08: d2sgpi_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2sgpE (E:)
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2sgpI (I:)
vdcseypkpactpeyrplcgsdnktygnkcnfcnavvesngtltlshfgkc