Lineage for d1e88a2 (1e88 A:102-160)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260117Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2260118Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2260280Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 2260281Protein Fibronectin [57462] (1 species)
  7. 2260282Species Human (Homo sapiens) [TaxId:9606] [57463] (4 PDB entries)
  8. 2260286Domain d1e88a2: 1e88 A:102-160 [44670]
    Other proteins in same PDB: d1e88a3
    complexed with nag

Details for d1e88a2

PDB Entry: 1e88 (more details)

PDB Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin
PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1e88a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e88a2 g.14.1.2 (A:102-160) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
vlvqtrggnsngalchfpflynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma

SCOPe Domain Coordinates for d1e88a2:

Click to download the PDB-style file with coordinates for d1e88a2.
(The format of our PDB-style files is described here.)

Timeline for d1e88a2: