| Class g: Small proteins [56992] (92 folds) |
| Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
| Family g.14.1.2: Fibronectin type II module [57459] (4 proteins) shorter two-disulfide version of a kringle module |
| Protein Fibronectin [57462] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57463] (4 PDB entries) |
| Domain d1e88a2: 1e88 A:102-160 [44670] Other proteins in same PDB: d1e88a3 complexed with nag |
PDB Entry: 1e88 (more details)
SCOPe Domain Sequences for d1e88a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e88a2 g.14.1.2 (A:102-160) Fibronectin {Human (Homo sapiens) [TaxId: 9606]}
vlvqtrggnsngalchfpflynnhnytdctsegrrdnmkwcgttqnydadqkfgfcpma
Timeline for d1e88a2: