Class g: Small proteins [56992] (75 folds) |
Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
Superfamily g.14.1: Kringle-like [57440] (2 families) |
Family g.14.1.1: Kringle modules [57441] (6 proteins) |
Protein NK1 fragment of hepatocyte growth factor [57457] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57458] (5 PDB entries) |
Domain d1nk1a2: 1nk1 A:126-209 [44665] Other proteins in same PDB: d1nk1a1, d1nk1b1 |
PDB Entry: 1nk1 (more details), 2.5 Å
SCOP Domain Sequences for d1nk1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nk1a2 g.14.1.1 (A:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens)} rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg gpwcftsnpevryevcdipqcsev
Timeline for d1nk1a2: