Lineage for d1nk1a2 (1nk1 A:126-209)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 428891Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 428892Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 428893Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 428910Protein NK1 fragment of hepatocyte growth factor [57457] (1 species)
  7. 428911Species Human (Homo sapiens) [TaxId:9606] [57458] (5 PDB entries)
  8. 428920Domain d1nk1a2: 1nk1 A:126-209 [44665]
    Other proteins in same PDB: d1nk1a1, d1nk1b1

Details for d1nk1a2

PDB Entry: 1nk1 (more details), 2.5 Å

PDB Description: nk1 fragment of human hepatocyte growth factor/scatter factor (hgf/sf) at 2.5 angstrom resolution

SCOP Domain Sequences for d1nk1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nk1a2 g.14.1.1 (A:126-209) NK1 fragment of hepatocyte growth factor {Human (Homo sapiens)}
rnciigkgrsykgtvsitksgikcqpwssmiphehsflpssyrgkdlqenycrnprgeeg
gpwcftsnpevryevcdipqcsev

SCOP Domain Coordinates for d1nk1a2:

Click to download the PDB-style file with coordinates for d1nk1a2.
(The format of our PDB-style files is described here.)

Timeline for d1nk1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nk1a1