![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein Apolipoprotein A [57455] (3 species) |
![]() | Species Human (Homo sapiens), IV-10/M66 variant [TaxId:9606] [57456] (3 PDB entries) |
![]() | Domain d3kiva_: 3kiv A: [44660] complexed with aca |
PDB Entry: 3kiv (more details), 1.8 Å
SCOPe Domain Sequences for d3kiva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kiva_ g.14.1.1 (A:) Apolipoprotein A {Human (Homo sapiens), IV-10/M66 variant [TaxId: 9606]} qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp wcfttdpsirweycnltrc
Timeline for d3kiva_: