PDB entry 3kiv

View 3kiv on RCSB PDB site
Description: recombinant kringle IV-10/m66 variant of human apolipoprotein(a)
Class: kringle
Keywords: kringle, lysine binding site, apolipoprotein(a)
Deposited on 1998-09-08, released 1999-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.182
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08519 (0-78)
      • variant (64)
    Domains in SCOPe 2.08: d3kiva_
  • Heterogens: ACA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3kivA (A:)
qcyhgngqsyrgtfsttvtgrtcqswssmtphrhqrtpenypndgltmnycrnpdadtgp
wcfttdpsirweycnltrc