Lineage for d2pf2_1 (2pf2 66-146)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 343037Fold g.14: Kringle-like [57439] (1 superfamily)
    disulphide-rich fold; nearly all-beta
  4. 343038Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 343039Family g.14.1.1: Kringle modules [57441] (6 proteins)
  6. 343105Protein Prothrombin [57448] (1 species)
  7. 343106Species Cow (Bos taurus) [TaxId:9913] [57449] (3 PDB entries)
  8. 343107Domain d2pf2_1: 2pf2 66-146 [44651]
    Other proteins in same PDB: d2pf2_2
    complexed with ca

Details for d2pf2_1

PDB Entry: 2pf2 (more details), 2.2 Å

PDB Description: the ca+2 ion and membrane binding structure of the gla domain of ca- prothrombin fragment 1

SCOP Domain Sequences for d2pf2_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pf2_1 g.14.1.1 (66-146) Prothrombin {Cow (Bos taurus)}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgq

SCOP Domain Coordinates for d2pf2_1:

Click to download the PDB-style file with coordinates for d2pf2_1.
(The format of our PDB-style files is described here.)

Timeline for d2pf2_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pf2_2