![]() | Class g: Small proteins [56992] (54 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) |
![]() | Superfamily g.14.1: Kringle-like [57440] (2 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (8 proteins) |
![]() | Protein Prothrombin fragment 1 and 2 [57448] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57449] (3 PDB entries) |
![]() | Domain d2pf2_1: 2pf2 66-146 [44651] Other proteins in same PDB: d2pf2_2 |
PDB Entry: 2pf2 (more details), 2.2 Å
SCOP Domain Sequences for d2pf2_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2pf2_1 g.14.1.1 (66-146) Prothrombin fragment 1 and 2 {Cow (Bos taurus)} caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp wcyttsptlrreecsvpvcgq
Timeline for d2pf2_1: