Lineage for d2pf2a1 (2pf2 A:66-146)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033377Protein Prothrombin [57448] (1 species)
  7. 3033378Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries)
  8. 3033381Domain d2pf2a1: 2pf2 A:66-146 [44651]
    Other proteins in same PDB: d2pf2a2
    complexed with ca

Details for d2pf2a1

PDB Entry: 2pf2 (more details), 2.2 Å

PDB Description: the ca+2 ion and membrane binding structure of the gla domain of ca- prothrombin fragment 1
PDB Compounds: (A:) prothrombin fragment 1

SCOPe Domain Sequences for d2pf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pf2a1 g.14.1.1 (A:66-146) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcgq

SCOPe Domain Coordinates for d2pf2a1:

Click to download the PDB-style file with coordinates for d2pf2a1.
(The format of our PDB-style files is described here.)

Timeline for d2pf2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2pf2a2