Lineage for d1cebb_ (1ceb B:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2260117Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2260118Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2260119Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 2260184Protein Plasminogen [63400] (1 species)
  7. 2260185Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 2260205Domain d1cebb_: 1ceb B: [44648]
    kringle 1
    complexed with amh

Details for d1cebb_

PDB Entry: 1ceb (more details), 2.07 Å

PDB Description: the structure of the non-covalent complex of recombinant kringle 1 domain of human plasminogen with amcha (trans-4- aminomethylcyclohexane-1-carboxylic acid)
PDB Compounds: (B:) plasminogen

SCOPe Domain Sequences for d1cebb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cebb_ g.14.1.1 (B:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg
pwcyttdpekrydycdilec

SCOPe Domain Coordinates for d1cebb_:

Click to download the PDB-style file with coordinates for d1cebb_.
(The format of our PDB-style files is described here.)

Timeline for d1cebb_: