![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein Plasminogen [63400] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries) |
![]() | Domain d1cebb_: 1ceb B: [44648] kringle 1 complexed with amh |
PDB Entry: 1ceb (more details), 2.07 Å
SCOPe Domain Sequences for d1cebb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cebb_ g.14.1.1 (B:) Plasminogen {Human (Homo sapiens) [TaxId: 9606]} ecktgngknyrgtmsktkngitcqkwsstsphrprfspathpsegleenycrnpdndpqg pwcyttdpekrydycdilec
Timeline for d1cebb_: