Lineage for d1ldl__ (1ldl -)

  1. Root: SCOP 1.57
  2. 88227Class g: Small proteins [56992] (56 folds)
  3. 89535Fold g.12: Ligand-binding domain of low-density lipoprotein receptor [57423] (1 superfamily)
  4. 89536Superfamily g.12.1: Ligand-binding domain of low-density lipoprotein receptor [57424] (1 family) (S)
  5. 89537Family g.12.1.1: Ligand-binding domain of low-density lipoprotein receptor [57425] (1 protein)
  6. 89538Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 89539Species Human (Homo sapiens) [TaxId:9606] [57427] (8 PDB entries)
  8. 89546Domain d1ldl__: 1ldl - [44615]

Details for d1ldl__

PDB Entry: 1ldl (more details)

PDB Description: three-dimensional structure of a cysteine-rich repeat from the low- density lipoprotein receptor

SCOP Domain Sequences for d1ldl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldl__ g.12.1.1 (-) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
avgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvt

SCOP Domain Coordinates for d1ldl__:

Click to download the PDB-style file with coordinates for d1ldl__.
(The format of our PDB-style files is described here.)

Timeline for d1ldl__: