Lineage for d1ldla_ (1ldl A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033148Fold g.12: LDL receptor-like module [57423] (1 superfamily)
    disulfide-rich calcium-binding fold
  4. 3033149Superfamily g.12.1: LDL receptor-like module [57424] (2 families) (S)
  5. 3033150Family g.12.1.1: LDL receptor-like module [57425] (6 proteins)
  6. 3033160Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 3033161Species Human (Homo sapiens) [TaxId:9606] [57427] (14 PDB entries)
    Uniprot P01130 272-353
  8. 3033172Domain d1ldla_: 1ldl A: [44615]
    first module

Details for d1ldla_

PDB Entry: 1ldl (more details)

PDB Description: three-dimensional structure of a cysteine-rich repeat from the low- density lipoprotein receptor
PDB Compounds: (A:) low-density lipoprotein receptor

SCOPe Domain Sequences for d1ldla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldla_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]}
avgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvt

SCOPe Domain Coordinates for d1ldla_:

Click to download the PDB-style file with coordinates for d1ldla_.
(The format of our PDB-style files is described here.)

Timeline for d1ldla_: