Class g: Small proteins [56992] (100 folds) |
Fold g.12: LDL receptor-like module [57423] (1 superfamily) disulfide-rich calcium-binding fold |
Superfamily g.12.1: LDL receptor-like module [57424] (2 families) |
Family g.12.1.1: LDL receptor-like module [57425] (6 proteins) |
Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57427] (14 PDB entries) Uniprot P01130 272-353 |
Domain d1ldla_: 1ldl A: [44615] first module |
PDB Entry: 1ldl (more details)
SCOPe Domain Sequences for d1ldla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ldla_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} avgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvt
Timeline for d1ldla_: