SCOP 1.55: Domain d1ldl__: 1ldl -

Lineage for d1ldl__ (1ldl -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.12: Ligand-binding domain of low-density lipoprotein receptor [57423] (1 superfamily)

4. Superfamily g.12.1: Ligand-binding domain of low-density lipoprotein receptor [57424] (1 family)

5. Family g.12.1.1: Ligand-binding domain of low-density lipoprotein receptor [57425] (1 protein)

6. Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57427] (8 PDB entries)

8. Domain d1ldl__: 1ldl - [44615]

Details for d1ldl__

PDB Entry: 1ldl

PDB Description: three-dimensional structure of a cysteine-rich repeat from the low- density lipoprotein receptor

SCOP Domain Sequences for d1ldl__:

Sequence; same for both SEQRES and ATOM records:

>d1ldl__ g.12.1.1 (-) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
avgdrcernefqcqdgkcisykwvcdgsaecqdgsdesqetclsvt

Timeline for d1ldl__:

• d1ldl__ appears in SCOP 1.57
  
• d1ldl__ appears in the current release, SCOPe 2.08, called d1ldla_