Lineage for d1ca0i_ (1ca0 I:)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 203527Fold g.8: BPTI-like [57361] (1 superfamily)
  4. 203528Superfamily g.8.1: BPTI-like [57362] (2 families) (S)
  5. 203529Family g.8.1.1: Small Kunitz-type ihibitors & BPTI-like toxins [57363] (11 proteins)
  6. 203533Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)
  7. 203534Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries)
  8. 203539Domain d1ca0i_: 1ca0 I: [44547]
    Other proteins in same PDB: d1ca0.1, d1ca0.2

Details for d1ca0i_

PDB Entry: 1ca0 (more details), 2.1 Å

PDB Description: bovine chymotrypsin complexed to appi

SCOP Domain Sequences for d1ca0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca0i_ g.8.1.1 (I:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens)}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

SCOP Domain Coordinates for d1ca0i_:

Click to download the PDB-style file with coordinates for d1ca0i_.
(The format of our PDB-style files is described here.)

Timeline for d1ca0i_: