Lineage for d1ccqa_ (1ccq A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2636875Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 2636954Protein Cardiotoxin II [57334] (2 species)
  7. 2636955Species Central asian cobra (Naja naja oxiana) [TaxId:8657] [57336] (3 PDB entries)
  8. 2636957Domain d1ccqa_: 1ccq A: [44443]

Details for d1ccqa_

PDB Entry: 1ccq (more details)

PDB Description: nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (minor form).
PDB Compounds: (A:) protein (cytotoxin 2)

SCOPe Domain Sequences for d1ccqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ccqa_ g.7.1.1 (A:) Cardiotoxin II {Central asian cobra (Naja naja oxiana) [TaxId: 8657]}
lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn

SCOPe Domain Coordinates for d1ccqa_:

Click to download the PDB-style file with coordinates for d1ccqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ccqa_: