SCOPe 2.08: Domain d1ccqa_: 1ccq A:

Lineage for d1ccqa_ (1ccq A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein Cardiotoxin II [57334] (2 species)

7. Species Central asian cobra (Naja naja oxiana) [TaxId:8657] [57336] (3 PDB entries)

8. Domain d1ccqa_: 1ccq A: [44443]

Details for d1ccqa_

PDB Entry: 1ccq

PDB Description: nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (minor form).

PDB Compounds: (A:) protein (cytotoxin 2)

SCOPe Domain Sequences for d1ccqa_:

Sequence; same for both SEQRES and ATOM records:

>d1ccqa_ g.7.1.1 (A:) Cardiotoxin II {Central asian cobra (Naja naja oxiana) [TaxId: 8657]}
lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn

Timeline for d1ccqa_:

• d1ccqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1ccqa_ appears in SCOPe 2.07