Lineage for d1ccqa_ (1ccq A:)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.7: Snake toxin-like [57301] (1 superfamily) Superfamily g.7.1: Snake toxin-like [57302] (3 families) 
Family g.7.1.1: Snake venom toxins [57303] (22 proteins) 
Protein Cardiotoxin II [57334] (2 species) Species Central asian cobra (Naja naja oxiana) [TaxId:8657] [57336] (3 PDB entries) 
Domain d1ccqa_: 1ccq A: [44443]
Details for d1ccqa_
PDB Entry: 1ccq (more details)
PDB Description: nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (minor form).
SCOP Domain Sequences for d1ccqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccqa_ g.7.1.1 (A:) Cardiotoxin II {Central asian cobra (Naja naja oxiana)}
lkckklvplfsktcpagknlcykmfmvaaphvpvkrgcidvcpkssllvkyvccntdkcn
SCOP Domain Coordinates for d1ccqa_:
Click to download the PDB-style file with coordinates for d1ccqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ccqa_:
- d1ccqa_ first appeared (with stable ids) in SCOP 1.55
- d1ccqa_ appears in SCOP 1.57
- d1ccqa_ appears in SCOP 1.61
- d1ccqa_ appears in the current release, SCOPe 2.08
View in 3D