Lineage for d1chvs_ (1chv S:)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 143453Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 143454Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 143455Family g.7.1.1: Snake venom toxins [57303] (22 proteins)
  6. 143503Protein Cardiotoxin II [57334] (2 species)
  7. 143508Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57335] (3 PDB entries)
  8. 143509Domain d1chvs_: 1chv S: [44438]

Details for d1chvs_

PDB Entry: 1chv (more details)

PDB Description: elucidation of the solution structure of cardiotoxin analogue v from the taiwan cobra (naja naja atra) venom

SCOP Domain Sequences for d1chvs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chvs_ g.7.1.1 (S:) Cardiotoxin II {Taiwan cobra (Naja naja atra)}
lkcnklvplfyktcpagknlcykmfmvsnkmvpvkrgcidvcpkssllvkyvccntdrcn

SCOP Domain Coordinates for d1chvs_:

Click to download the PDB-style file with coordinates for d1chvs_.
(The format of our PDB-style files is described here.)

Timeline for d1chvs_: