Lineage for d1chvs_ (1chv S:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. Protein Cardiotoxin II [57334] (2 species)
  7. Species Taiwan cobra (Naja naja atra) [TaxId:8656] [57335] (4 PDB entries)
  8. Domain d1chvs_: 1chv S: [44438]

Details for d1chvs_

PDB Entry: 1chv (more details)

PDB Description: elucidation of the solution structure of cardiotoxin analogue v from the taiwan cobra (naja naja atra) venom
PDB Compounds: (S:) protein (cardiotoxin analogue v)

SCOPe Domain Sequences for d1chvs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1chvs_ g.7.1.1 (S:) Cardiotoxin II {Taiwan cobra (Naja naja atra) [TaxId: 8656]}
lkcnklvplfyktcpagknlcykmfmvsnkmvpvkrgcidvcpkssllvkyvccntdrcn

SCOPe Domain Coordinates for d1chvs_ are not available.

Timeline for d1chvs_: