SCOPe 2.08: Domain d1cxoa_: 1cxo A:

Lineage for d1cxoa_ (1cxo A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
   automatically mapped to Pfam PF00087

6. Protein gamma-Cardiotoxin [57306] (1 species)

7. Species Snake (Naja nigricollis) [TaxId:8654] [57307] (3 PDB entries)

8. Domain d1cxoa_: 1cxo A: [44402]

Details for d1cxoa_

PDB Entry: 1cxo

PDB Description: refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organisation suggests the existence of a possible phospholipid binding site

PDB Compounds: (A:) cardiotoxin gamma

SCOPe Domain Sequences for d1cxoa_:

Sequence; same for both SEQRES and ATOM records:

>d1cxoa_ g.7.1.1 (A:) gamma-Cardiotoxin {Snake (Naja nigricollis) [TaxId: 8654]}
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn

Timeline for d1cxoa_:

• d1cxoa_ first appeared (with stable ids) in SCOP 1.55, called d1cxo__
  
• d1cxoa_ appears in SCOPe 2.07