SCOP 1.55: Domain d1cxo__: 1cxo -

Lineage for d1cxo__ (1cxo -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.1: Snake venom toxins [57303] (21 proteins)

6. Protein gamma-Cardiotoxin [57306] (1 species)

7. Species Snake (Naja nigricollis) [TaxId:8654] [57307] (3 PDB entries)

8. Domain d1cxo__: 1cxo - [44402]

Details for d1cxo__

PDB Entry: 1cxo

PDB Description: refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organisation suggests the existence of a possible phospholipid binding site

SCOP Domain Sequences for d1cxo__:

Sequence; same for both SEQRES and ATOM records:

>d1cxo__ g.7.1.1 (-) gamma-Cardiotoxin {Snake (Naja nigricollis)}
lkcnqlippfwktcpkgknlcykmtmraapmvpvkrgcidvcpkssllikymccntdkcn

Timeline for d1cxo__:

• d1cxo__ appears in SCOP 1.57
  
• d1cxo__ appears in the current release, SCOPe 2.08, called d1cxoa_