Lineage for d1hica_ (1hic A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258920Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families) (S)
  5. 2258942Family g.3.15.2: Hirudin-like [57270] (4 proteins)
  6. 2258951Protein Hirudin [57271] (1 species)
  7. 2258952Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57272] (9 PDB entries)
  8. 2258957Domain d1hica_: 1hic A: [44371]

Details for d1hica_

PDB Entry: 1hic (more details)

PDB Description: the nmr solution structure of hirudin(1-51) and comparison with corresponding three-dimensional structures determined using the complete 65-residue hirudin polypeptide chain
PDB Compounds: (A:) hirudin variant

SCOPe Domain Sequences for d1hica_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hica_ g.3.15.2 (A:) Hirudin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpqsh

SCOPe Domain Coordinates for d1hica_:

Click to download the PDB-style file with coordinates for d1hica_.
(The format of our PDB-style files is described here.)

Timeline for d1hica_: