Lineage for d1dx5l2 (1dx5 L:388-422)

  1. Root: SCOPe 2.02
  2. 1239924Class g: Small proteins [56992] (90 folds)
  3. 1240201Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1240965Superfamily g.3.11: EGF/Laminin [57196] (7 families) (S)
  5. 1240966Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1241312Protein Thrombomodulin, different EGF-like domains [57225] (1 species)
  7. 1241313Species Human (Homo sapiens) [TaxId:9606] [57226] (6 PDB entries)
  8. 1241324Domain d1dx5l2: 1dx5 L:388-422 [44312]
    Other proteins in same PDB: d1dx5.1, d1dx5.2, d1dx5.3, d1dx5.4
    complexed with ca, fmt, na, ndg

Details for d1dx5l2

PDB Entry: 1dx5 (more details), 2.3 Å

PDB Description: crystal structure of the thrombin-thrombomodulin complex
PDB Compounds: (L:) thrombomodulin

SCOPe Domain Sequences for d1dx5l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dx5l2 g.3.11.1 (L:388-422) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]}
mfcnqtacpadcdpntqascecpegyilddgfict

SCOPe Domain Coordinates for d1dx5l2:

Click to download the PDB-style file with coordinates for d1dx5l2.
(The format of our PDB-style files is described here.)

Timeline for d1dx5l2: