![]() | Class g: Small proteins [56992] (91 folds) |
![]() | Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
![]() | Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
![]() | Family g.3.11.1: EGF-type module [57197] (23 proteins) |
![]() | Protein Epidermal growth factor, EGF [57215] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57216] (8 PDB entries) |
![]() | Domain d1epga_: 1epg A: [44286] |
PDB Entry: 1epg (more details)
SCOPe Domain Sequences for d1epga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1epga_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr
Timeline for d1epga_: