Lineage for d1epg__ (1epg -)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies) 
Superfamily g.3.11: EGF/Laminin [57196] (4 families) 
Family g.3.11.1: EGF-type module [57197] (16 proteins) 
Protein Epidermal growth factor, EGF [57215] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [57216] (7 PDB entries) 
Domain d1epg__: 1epg - [44286]
Details for d1epg__
PDB Entry: 1epg (more details)
PDB Description: three-dimensional nuclear magnetic resonance structures of mouse epidermal growth factor in acidic and physiological ph solutions
SCOP Domain Sequences for d1epg__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1epg__ g.3.11.1 (-) Epidermal growth factor, EGF {Mouse (Mus musculus)}
nsypgcpssydgyclnggvcmhiesldsytcncvigysgdrcqtrdlrwwelr
SCOP Domain Coordinates for d1epg__:
Click to download the PDB-style file with coordinates for d1epg__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1epg__:
- d1epg__ appears in SCOP 1.57
- d1epg__ appears in the current release, SCOPe 2.08, called d1epga_
View in 3D