SCOP 1.63: Domain d5coxd2: 5cox D:33-73

Lineage for d5coxd2 (5cox D:33-73)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (17 superfamilies)
   disulphide-bound fold; contains beta-hairpin with two adjacent disulphides

4. Superfamily g.3.11: EGF/Laminin [57196] (6 families)

5. Family g.3.11.1: EGF-type module [57197] (18 proteins)

6. Protein Prostaglandin H2 synthase-1, EGF-like module [57210] (2 species)
   the rest of protein is heme-linked peroxidase, all-alpha fold

7. Species Mouse (Mus musculus) [TaxId:10090] [57212] (7 PDB entries)

8. Domain d5coxd2: 5cox D:33-73 [44282]
   Other proteins in same PDB: d5coxa1, d5coxb1, d5coxc1, d5coxd1
   complexed with hem, nag

Details for d5coxd2

PDB Entry: 5cox, 3 Å

PDB Description: uninhibited mouse cyclooxygenase-2 (prostaglandin synthase-2)

SCOP Domain Sequences for d5coxd2:

Sequence; same for both SEQRES and ATOM records:

>d5coxd2 g.3.11.1 (D:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus)}
anpccsnpcqnrgecmstgfdqykcdctrtgfygencttpe

Timeline for d5coxd2:

• d5coxd2 first appeared (with stable ids) in SCOP 1.55
  
• d5coxd2 appears in SCOP 1.61
  
• d5coxd2 appears in SCOP 1.65
  
• d5coxd2 appears in the current release, SCOPe 2.08